45 Best Women In Leadership Blogs and Websites

1. Lolly Daskal Blog

Lolly Daskal is one of the most sought-after executive leadership coaches in the world.As founder and CEO of Lead From Within, her proprietary leadership program is engineered to be a catalyst for leaders who want to enhance performance and make a meaningful difference intheir companies, their lives, and the world.Keep up with articles on Leadership Development and Organizational Development by subscribing her blog.
lollydaskal.com
Facebook Followers 15.4KTwitter Followers 1.2M Frequency 1 post / day Domain Authority 50 Get Email Contact

2. Progressive Women's Leadership

Progressive Women's Leadership is a resource center and community that's empowering, forward-looking and supportive of both women and men who want to change the way women are viewed in the workplace and beyond. Subscribe to get expert guidance to develop leaders among women.
progressivewomensleadership.com
Facebook Followers 6.8KTwitter Followers 2.1K Frequency 19 posts / quarter Domain Authority 36 Get Email Contact

3. Red Shoe Movement

The Red Shoe Movement is a leading company dedicated to the career and leadership development of women. Diversity & Inclusion is in our DNA. We Provide Career and Leadership Development Programs for your Latina Employees.
redshoemovement.com
Facebook Followers 2.5KTwitter Followers 25.8K Frequency 2 posts / month Domain Authority 46 Get Email Contact

4. Outstmart Your Brain Blog

Dr. Marcia Reynolds, president of Covisioning LLC is the master of teaching others how to engage in powerful conversations that connect, influence, and activate change, even when emotions are strong. Subscribe for tips on Leadership and Communication Strategies based on the latest research.
outsmartyourbrain.com
Facebook Followers 1.1KTwitter Followers 6K Frequency 2 posts / quarter Since Dec 2007 Domain Authority 47 Get Email Contact

5. LaRae Quy Blog

LaRae Quy is former FBI counterintelligence and undercover agent and founder of the Mental Toughness Center. She writes for audiences who are hungry, scrappy, and ambitious in the pursuit of their goals, and drawing upon her own experiences as an FBI agent, she shows them how grit trumps talent by combining hard-nosed neuroscience with social psychology.
laraequy.com
Facebook Followers 2.1KTwitter Followers 74.4KInstagram Followers 875 Frequency 1 post / month Since May 2013 Domain Authority 39 Get Email Contact

6. SmartTribes Institute Blog

We believe every company can forge a culture of safety, belonging and mattering. We help leaders to create this, to see into their blind spots, to expand their vision, and to help themselves and their teams to perform at new levels while fostering deep fulfillment in their work. Keep up with posts on Neuroscience-Based Executive Coaching, Training, Leadership and Culture Performance by subscribing this blog.
smarttribesinstitute.com
Facebook Followers 7KTwitter Followers 50.7K Frequency 1 post / month Since Dec 2007 Domain Authority 38 Get Email Contact

7. NextMapping Blog

Cheryl Cran is the founder of NextMapping. NextMapping.com and the CEO of parent company Synthesis at Work Inc. Recognized as the #1 Future of Work influencer by Onalytica, and author of 7 books including NextMapping. How Great Leaders Inspire Everyone to Create the Future of Work. Follow her blog for all things related to the future of work.Guest bloggers include CIO's, Behavioral Scientists, CEO's, Data Scientists including posts by founder Cheryl Cran.
nextmapping.com
Twitter Followers 17.8KInstagram Followers 8.3K Frequency 1 post / month Since Mar 2011 Domain Authority 34 Get Email Contact

8. Entrepreneur » Women Leaders

Get the latest news, videos, and discussion topics on Women Leaders, illuminating upon the increased, diversified role and actions women are taking up in the Corporate culture. Entrepreneur Magazine is the definitive guide to all the diverse challenges of business owners across the globe.
entrepreneur.com
Facebook Followers 5.2MTwitter Followers 3.6MInstagram Followers 4.5M Frequency 1 post / quarter Domain Authority 92 Get Email Contact

9. Ask a Manager

Ask A Manager by Allison Green discusses all the usual questions and doubts regarding Work Behaviour, Coordination between Bosses and Co-workers, How to navigate the difficult areas in Corporate, and more insightful stuff for women. Covered topics include internships, Job searches Hiring advice, and Boss-employee relations.
askamanager.org
Facebook Followers 32.2KTwitter Followers 96.2K Frequency 3 posts / day Domain Authority 70 Get Email Contact

10. Psychology Today | A New Look at Women's Leadership

The Psychology Today blog takes a new look at Women's Leadership, by applying psychological and organizational principles to understand, support, and empower female leaders. Psychology Today is one of the world's largest mental health and behavioral science destinations online. All our content is entirely and exclusively dedicated to human behavior.
psychologytoday.com
Facebook Followers 7.4MTwitter Followers 1.3MInstagram Followers 687.7K Frequency 2 posts / month Domain Authority 93 Get Email Contact

11. She Owns It Blog

Features guest posts on the latest Entrepreneurial practices, tips, and advice on management, along with buzzing trends and lifestyle profiles. She Owns It is a media marketing company blog that focuses on female individuals in corporate to help grow their careers.
sheownsit.com
Facebook Followers 5.6KTwitter Followers 122.3KInstagram Followers 2.6K Frequency 4 posts / week Since Nov 2010 Domain Authority 41 Get Email Contact

12. girlboss Blog

Girlboss is a modern media company that offers navigation and the future of work to ambitious women. Discover more through their blog that aims to be a handy resource for women providing them with management tips, financial advice, the latest lifestyle trends, success stories of other remarkable women, and more valuable content.
girlboss.com
Facebook Followers 147.6KTwitter Followers 66.4KInstagram Followers 2M Frequency 1 post / day Domain Authority 78 Get Email Contact

13. Take The Lead Blog

Our Blog 'The Movement shares various insights and resources with young women on how to understand and utilize the power of leadership tools to focus and implement their career goals, both in corporate and politics. Take The Lead is a non-profit that prepares, develops, and inspires all women of all diversities to take their share of leadership positions across sectors.
taketheleadwomen.com
Facebook Followers 8.5KTwitter Followers 22.4KInstagram Followers 3.5K Frequency 1 post / week Domain Authority 49 Get Email Contact

14. Comstock's magazine » Women in Leadership

Comstock Magazine is the premier monthly business publication in California's Capital Region providing Intriguing, insightful, and inquisitive editorials analyses in online and in print. Gain business insight and original journalism for California's Capital Region, including Sacramento, Placer, El Dorado, Yolo, Solano and surrounding areas.
comstocksmag.com
Facebook Followers 8.7KTwitter Followers 8.2KInstagram Followers 10.3K Frequency 1 post / quarter Domain Authority 50 Get Email Contact

15. Center for Creative Leadership » Women's Leadership

Read our featured Articles, Podcasts, Case studies and analyses, and more informational content on Women's Leadership and Leading Effectively in today's corporate culture. Center for Creative Leadership is a top-ranked, nonprofit provider of leadership development and a pioneer in the field of global leadership research.
ccl.org
Facebook Followers 193.2KTwitter Followers 22.2KInstagram Followers 8.5K Frequency 5 posts / year Domain Authority 63 Get Email Contact

16. SC Women In Leadership Blog

SC WIL blog features articles contributed by our readers with perspectives as varied as a sixth-grader, a businesswoman, a voting expert, a liberal journalist, and a conservative problem-solver. SC Women in Leadership (SC WIL) is a state-wide, multi-partisan group of women and men working together across differences by informing, inspiring, and involving women in leadership.
scwomenlead.net
Facebook Followers 3.2KTwitter Followers 1.2K Frequency 1 post / week Domain Authority 30 Get Email Contact

17. Latterly

Latterly is a blog supporting female leaders in everything from how to build leadership skills to how to dress the part. Discover simple, easy and effective methods to balance your work life and holistically advance your career growth.
latterly.org
Frequency 8 posts / day Domain Authority 39 Get Email Contact

18. InPower Coaching Blog

Posts on how to achieve Diversity, Equity, and Inclusion, and the latest updates from InPower Coaching. At InPower Women we are dedicated to reshaping the narrative about women and power because when we speak about ourselves without shame or apology, others treat us with more credibility and respect.
inpowercoaching.com
Facebook Followers 498Twitter Followers 6K Frequency 4 posts / month Since May 2011 Domain Authority 42 Get Email Contact

19. Women and Leadership Archives

Women and Leadership Archives (WLA) collects and makes available permanently valuable records of women and women's organizations, which document women's lives, roles, and contributions. Read blogs from our staff and guest writers on the remarkable history of feminist leadership.
libblogs.luc.edu
Facebook Followers 775 Frequency 1 post / quarter Domain Authority 71 Get Email Contact

20. Linkage

Gain valuable insights from Linkage experts on how your organizaiton improve your leadership thinking through current and past in-person experiences. Linkage is a global leadership development firm committed to advancing women and accelerating inclusion in leaders and organizations.
linkageinc.com
Facebook Followers 3.3KTwitter Followers 4.6KInstagram Followers 1.1K Frequency 1 post / quarter Domain Authority 43 Get Email Contact

21. Nisha Moodley Blog

Women's Leadership Coach & Founder of Global Sisterhood Day. Retreats, masterminds & coaching for ambitious women on a mission, with a focus on heart-mind-message alignment.
nishamoodley.com
Facebook Followers 16KTwitter Followers 8.9KInstagram Followers 28.5K Frequency 1 post / year Domain Authority 33 Get Email Contact

22. SHAMBAUGH Leadership Blog

Our blog details Leadership strategies for women and tips to manage stress and work-life demand among other useful insights. SHAMBAUGH is a woman-owned business that was founded by Rebecca Shambaugh pioneering leadership development programs that focus on the advancement of women leaders in the workforce.
shambaughleadership.com
Facebook Followers 1.2KTwitter Followers 1K Frequency 1 post / week Domain Authority 29 Get Email Contact

23. How Women Lead Blog

How Women Lead is a national organization of top executive women focused on activating their individual and collective power to influence the change they want to see in the world through leadership, investment and philanthropy.
howwomenlead.com
Facebook Followers 1.7KTwitter Followers 265Instagram Followers 1.4K Frequency 1 post / week Domain Authority 33 Get Email Contact

24. WiBF Blog

WiBF Blog presents tactful insight and thought leadership on how to navigate their career journey for women in Banking and related fields. Learn news and updates in the latest posts. WiBF is a not-for-profit membership association aimed at increasing the representation of female leaders in the banking and finance sector.
wibf.org.au
Facebook Followers 174Twitter Followers 755Instagram Followers 1.9K Frequency 1 post / week Domain Authority 23 Get Email Contact

25. Women's Leadership Institute Blog

Articles on the best practices and insights on how to run and manage businesses for women from our experts at the Women's Leadership Institute. The Women's Leadership Institute is a non-profit engaged with Utah business leaders to help them elevate the stature of women in business and board rooms through our ElevateHER Challenge and other programs.
wliut.com/blog
Facebook Followers 1.9KTwitter Followers 936Instagram Followers 3.3K Frequency 1 post / quarter Domain Authority 36 Get Email Contact

26. ZeroGap Blog

ZeroGap.co is an engaging Leadership Training & Development for Women. Increase clarity, and confidence, and develop your personal leadership for women leaders in traditionally male-dominated industries. Check out success stories, and valuable insights, and career lessons in our blogs.
zerogap.co/blog
Twitter Followers 268Instagram Followers 1K Frequency 1 post / quarter Domain Authority 23 Get Email Contact

27. Women Leaders for Christian Education

Recollections from the Bible on Leadership and Faith values for Women. Read pragmatic, helpful advice for women on how to deal with issues they face and also thoughts on Diversity, Equity, and Inclusion. Women Leaders for Christian Education is an online platform to inform, educate and support women leaders in Christian education
wlce.org
Facebook Followers 10Twitter Followers 245 Frequency 2 posts / quarter Domain Authority 9 Get Email Contact

28. YWomen

Jeffery Tobias Halter is the country's leading male expert on advancing women and engaging men. He is the President of YWomen, a strategic consulting company focused on engaging men in women's leadership issues. YWomen helps organizations create Integrated Women's Leadership Strategies, drive actionable business plans and strategies to attract, retain and advance women and address gender bias in the workplace. Jeffery is the former Director of Diversity Strategy for The Coca-Cola Company.
ywomen.biz
Facebook Followers 178 Frequency 14 posts / year Since Mar 2015 Domain Authority 35 Get Email Contact

29. Women In Leadership For Life Blog

Women In Leadership For Life (WILL) is dedicated to supporting women in living a fully expressed life and to being their personal leadership best.Linda and Lillas, and guest bloggers from our Women In Leadership For Life community, bring you inspiration, wisdom, and practical tips on topics to help you live fully expressed and your personal leadership best.
womeninleadershipforlife.ca
Frequency 2 posts / quarter Domain Authority 10 Get Email Contact

30. Leading NOW Blog

Leading NOW's blog features insights from Leading Forward, Leading Women, Center for Diversity & Inclusion, and the Gender Dynamics Institute. Leading NOW is defining the future of inclusive leadership development for the 21st Century.
leadingnow.biz
Facebook Followers 30Twitter Followers 30Instagram Followers 125 Frequency 1 post / month Domain Authority 34 Get Email Contact

31. Women Lead Sports Blog

Women Lead Sports Blog documents inspiring stories, achievements, consequential changes, case studies, for Women in sports, and more. Women Leads Sport (WLS) is a 4-week live online, action-oriented, and intense learning program for women who want to participate in decision-making within their sports organizations worldwide actively.
womenleadsports.com
Frequency 1 post / week Domain Authority 6 Get Email Contact

32. Heather Graham Leadership

Heather Graham is a Transformation Leader, Professor, and Coach with a passion for promoting the advancement of women in the fields of science, technology, engineering, and mathematics (STEM). Heather has a Bachelor's in Computer Science, a Master's in Management of Information Systems, and a Master's in Leadership and Coaching.
heathergrahamleadership.com
Facebook Followers 50Twitter Followers 11 Frequency 2 posts / quarter Domain Authority 1 Get Email Contact

33. Global Female Leaders Blog

The Global Female Leaders summit brings together high-achieving leaders from all over the world. Their mission is to discuss global challenges and issues, explore current trends and innovations shaping tomorrow's business realities. Subscribe their blog to get latest updates in your inbox, each morning.
globalfemaleleaders.com
Facebook Followers 981Twitter Followers 4.8KInstagram Followers 1.9K Frequency 9 posts / year Domain Authority 35 Get Email Contact

34. Women's Leadership Program Blog

The Women's Leadership Program promotes excellence in academic achievement, fosters strong community building, and provides the framework upon which students can develop their own leadership identity.Read guest articles, news reports, and inspiring stories from experts.
wlp.gwu.edu
Facebook Followers 589Twitter Followers 516Instagram Followers 1.2K Frequency 3 posts / year Domain Authority 80 Get Email Contact

35. Her Agenda

Her Agenda provides inspiration through the stories of real women who are succeeding in their industry while also highlighting the information and resources needed to achieve that success. Resources include the latest in events, scholarships, conferences, internships and job opportunities for young women to reach their full potential.
heragenda.com
Facebook Followers 6.4KTwitter Followers 20KInstagram Followers 73.7K Frequency 30 posts / year Domain Authority 52 Get Email Contact

36. Women & Leadership Australia

Based on a simple truth, that women still represent an enormously under-utilised national resource, Women & Leadership Australia (WLA) is dedicated to developing female leaders and supporting the increased presence of women in business and community leadership roles.
wla.edu.au/news
Facebook Followers 23.1KTwitter Followers 2.9KInstagram Followers 3K Frequency 11 posts / year Domain Authority 38 Get Email Contact

37. Women's Public Leadership Network Blog

Stay connected with WPLN and access our free online resources and insights for women and individuals curious about the political process in our country. Women's Public Leadership Network (WPLN) is a non-profit organization that educates, organizes, and inspires center- and right-leaning women to seek public office and become effective leaders.
womenspublicleadership.net
Facebook Followers 1.5KTwitter Followers 1.7KInstagram Followers 1.4K Frequency 3 posts / quarter Domain Authority 28 Get Email Contact

38. The Corporate Magazine » Women Leaders

The Corporate Magazine is a digital platform that recognizes the most unique and innovative leaders from all companies globally and brings them forth by highlighting their revolutionary approach toward unraveling the numerous challenges in their respective industries. Read about Women Leaders who are all set to create the best-of-breed future entrepreneurs teaching methodologies that are among the best-kept secrets.
thecorporatemagazine.com
Twitter Followers 1.5K Frequency 12 posts / year Domain Authority 12 Get Email Contact

39. The WIT Network | Business and Leadership Blogs

Welcome to our blogs page that provide insights, best practices and recognition for companies focused on Diversity, Equity and Inclusion. There are lots of stories to share as we work as a global community to support women on their career journey.
thewitnetwork.com
Frequency 5 posts / year Domain Authority 29 Get Email Contact

40. Guelph Women in Leadership

Guelph Women in Leadership (GWIL) was founded in 2014 and is aimed at providing inspiration, leadership, and empowerment for all students, particularly women. The mission is to give students the opportunity to educate, empower, and inspire each other through events and initiatives that focus on gender equity and female empowerment.
guelphwomeninleadership.com
Facebook Followers 807Instagram Followers 2.3K Domain Authority 8 Get Email Contact

41. Nexus Blog

The Women in Leadership Nexus was created to help you become this type of leader, the next-gen leader. Get Insights and blog posts about topics surrounding leadership, entrepreneurship, culture, professional development and negotiation.
wilnexus.com
Facebook Followers 720Twitter Followers 111Instagram Followers 308 Domain Authority 13 Get Email Contact

42. The Global Female Civility Leadership Institute

The Global Female Civility Leadership Institute is a non-governmental accredited academic institution recognized with special honors for its exceptional educational efforts. We provide a real-time perspective and curriculum for implementing authentic leadership relational and organizational diplomacy, emphasizing civility.
theglobalfemalecivilityleadershipinstitute.org
Facebook Followers 367Instagram Followers 1.2K Domain Authority 3 Get Email Contact